PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do023046.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 309aa    MW: 35112.9 Da    PI: 8.3645
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do023046.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA37.43.6e-12162192131
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyr 31 
                 CsnC + +Tp WR+gp+g  +LCnaCGl+ +
  Do023046.1 162 CSNCLSCETPRWRNGPSGIQMLCNACGLRLK 192
                 ****************************988 PP

2GATA57.22.2e-18240274135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C++C ++kTp+WR+gp g+ktLCnaCG+++++ +l
  Do023046.1 240 CTHCMSSKTPQWRSGPLGPKTLCNACGVRFKSGRL 274
                 *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004016.1E-9156207IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.769156192IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.55E-11158195No hitNo description
Gene3DG3DSA:3.30.50.109.2E-13161194IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.30E-10161192No hitNo description
PROSITE patternPS003440162187IPR000679Zinc finger, GATA-type
PfamPF003205.5E-10162192IPR000679Zinc finger, GATA-type
SMARTSM004011.2E-16234288IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.701234270IPR000679Zinc finger, GATA-type
SuperFamilySSF577167.13E-14235298No hitNo description
Gene3DG3DSA:3.30.50.106.2E-14238272IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.59E-13239296No hitNo description
PfamPF003204.0E-16240274IPR000679Zinc finger, GATA-type
PROSITE patternPS003440240265IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MDVHPVNAAA DSLGDLFPHQ AAAMESDDSN IEWLSGYVEH CFSSSTSYTN PVFARSAPTM  60
ANQGAGKPKL PPPSSSNGKR KKRSLASVMG NEDDQQYIIP LYVEPPLLLI DQKHWMAESE  120
LILPKKDKDP EVCQQQEQEQ EEEKCEKVEL MQFRQERLVK RCSNCLSCET PRWRNGPSGI  180
QMLCNACGLR LKPENQFTEQ YGQETKKEQE PGKRRDKKKK IIKKTYLNEE LSSEHPEKRC  240
THCMSSKTPQ WRSGPLGPKT LCNACGVRFK SGRLLPEYRP ANSPTFVSCL HSNSHKKVMQ  300
LRQAIAYQE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212219KRRDKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963249.11e-179PREDICTED: GATA transcription factor 2-like
TrEMBLK3Z8571e-179K3Z857_SETIT; Uncharacterized protein
STRINGSi022727m1e-179(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.14e-35GATA transcription factor 4